PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02470.1.p
Common NameEUGRSUZ_K02470, LOC104425974
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 348aa    MW: 38289.6 Da    PI: 6.4363
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02470.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd  lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Eucgr.K02470.1.p 14 KGPWTPEEDIVLVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T +E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Eucgr.K02470.1.p  67 RGSFTDQEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.563961IPR017930Myb domain
SuperFamilySSF466891.09E-2911108IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
CDDcd001674.62E-111661No hitNo description
PROSITE profilePS5129424.25262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465117IPR009057Homeodomain-like
SMARTSM007174.2E-1566114IPR001005SANT/Myb domain
PfamPF002492.0E-1467112IPR001005SANT/Myb domain
CDDcd001671.34E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRPPCCDKT GVKKGPWTPE EDIVLVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGSF TDQEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLQ  120
GQANPDDDDH NHHPQGFNAT SHSNPKGQWE RKLQTDIHTA KQALYEALSL DNQHSFLNET  180
TTALGDGGGV CDRPPHQESS YASSTKNIAR LLEGWMKSSP ISGKIKVETA ARSANVSNKM  240
AAAAGSRSTS EGGVAGVATP ECLDSLFSFN SSNSDVSQSV SADENNVNLT PETSTIFQEE  300
SKPGLESNDN HQVPIKLLEK WLLDDAAAQA LQDDYLMDMA LDQDALF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-261411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02470.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037166.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-120MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A059A5230.0A0A059A523_EUCGR; Uncharacterized protein
STRINGSolyc03g116100.2.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.12e-97myb domain protein 94